FOXO4-DRI × 10 Vials
FOXO4-DRI × 10 Vials
people are viewing this right now
Product was out of stock.
Product is unavailable.
Enjoy free shipping on every order, delivered to your doorstep no matter where you are in the world.
Shop with confidence with our hassle-free returns policy, ensuring you love what you buy.
Designed with the planet in mind, all our products are committed to sustainable practices.
Your payment information is always protected with our advanced, encrypted checkout security.
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids)
Molecular Formula: C228H388N86O64
Molecular Weight: 5358 g/mol
Synonyms: Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431
